General Information

  • ID:  hor005542
  • Uniprot ID:  P09655
  • Protein name:  Serine protease inhibitor Kazal-type 1
  • Gene name:  Spink1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007263 nitric oxide mediated signal transduction; GO:0010751 negative regulation of nitric oxide mediated signal transduction; GO:0031667 response to nutrient levels; GO:0045471 response to ethanol; GO:0048240 sperm capacitation; GO:0050679 positive regulation of epithelial cell proliferation; GO:0050732 negative regulation of peptidyl-tyrosine phosphorylation; GO:0060046 regulation of acrosome reaction; GO:0071375 cellular response to peptide hormone stimulus; GO:0090187 positive regulation of pancreatic juice secretion; GO:0090277 positive regulation of peptide hormone secretion; GO:0090281 negative regulation of calcium ion import; GO:2001256 regulation of store-operated calcium entry
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GNPPAEVNGKTPNCPKQIMGCPRIYDPVCGTNGITYPSECSLCFENRKFGTSIHIQRRGTC
  • Length:  61(19-79)
  • Propeptide:  MKVAIIFLLSALALLSLAGNPPAEVNGKTPNCPKQIMGCPRIYDPVCGTNGITYPSECSLCFENRKFGTSIHIQRRGTC
  • Signal peptide:  MKVAIIFLLSALALLSLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  14-43; 21-40; 29-61
  • Structure ID:  AF-P09655-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005542_AF2.pdbhor005542_ESM.pdb

Physical Information

Mass: 772899 Formula: C283H449N85O87S7
Absent amino acids: W Common amino acids: GPC
pI: 8.38 Basic residues: 8
Polar residues: 28 Hydrophobic residues: 11
Hydrophobicity: -57.21 Boman Index: -11577
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 49.51
Instability Index: 4822.95 Extinction Coefficient cystines: 3355
Absorbance 280nm: 55.92

Literature

  • PubMed ID:  3202973
  • Title:  Purification, characterization and amino-acid sequencing of two pancreatic secretory trypsin inhibitors in rat pancreatic juice.
  • PubMed ID:  3597401
  • Title:  Purification and sequencing of a trypsin-sensitive cholecystokinin-releasing peptide from rat pancreatic juice. Its homology